Cluster: cluster_869

CRISPR-Cas subtypes that co-occur with the candidate	CAS-I-E: 107
Percentage of cluster members that co-occur with known Acrs	0.94
Percentage of cluster members that are adjacent to an HTH protein	3.74
Mean length of the directons containing the candidates	2.046728971962617
Percent of cluster members that occur in self-targeting genomes	0.94
Number of members in the cluster	107
Model score for cluster	0.18
Consensus sequence	MSAKNANFQLTITKAQVAIKSCPSWHTGFQWNHNDQLLHSCIPDSPTTQIFSICCYLKRK RTNARVFHHVLLLIACDLFLPHGTFFQLEIFILQPVRIVYSSTTLPAPPYDGPL
Accessions (where available) / Location	KNF92800.1 KPO90436.1 KLH23309.1 KPO93182.1 KNF55968.1 KOZ50114.1 KPP16773.1 KXN41352.1 KPH28598.1 KPP12867.1 KPP48206.1 KXN59728.1 KXM30946.1 KKK28993.1 KOZ75449.1 KXM88605.1 KUP14963.1 KXL85585.1 KXM84959.1 KXN01844.1 KPH36901.1 KLH62794.1 KOZ20663.1 KIY27042.1 KJW53858.1 KOZ54624.1 KXN45848.1 KXM78831.1 KOZ18813.1 AIF92681.1 KLH44535.1 BAB34522.1 KNZ24375.1 KOZ69945.1 KXL92080.1 KLH56790.1 KLH43791.1 KXM45922.1 KJJ47261.1 KNF42408.1 KXM64702.1 KXM49005.1 KXL71047.1 KXN21705.1 KPH28689.1 KOZ34647.1 KPO87086.1 KXN58440.1 AFJ28110.1 KPO42428.1 KXN01098.1 KXM16846.1 KOZ53669.1 KXM15473.1 KML88088.1 KPO72842.1 KST35665.1 KOZ56565.1 KXK86182.1 KOZ90894.1 KKB19199.1 KXM32032.1 KPP34168.1 KLH56063.1 KXM44767.1 KML75081.1 KJW22767.1 KXM82091.1 KPP29073.1 KOZ06827.1 KJW36743.1 KXM77672.1 KXN29991.1 KOZ74411.1 KJW71892.1 KLH42616.1 KXN46576.1 KXL99383.1 KOZ38248.1 KXN30400.1 KIZ08044.1 AKC12285.1 KNY93412.1 KPO63563.1 KXM29349.1 KXL68942.1 KXM99509.1 KPH40424.1 KPP36486.1 ALH89794.1 AMG79243.1 KOZ03190.1 KXN56269.1 KML73070.1 KXL55118.1 KXM03188.1 KNG05708.1 KRQ16618.1 KJY13206.1 KXM65771.1 KPP37227.1 KOZ22272.1 KKF80758.1 KPO31025.1 AMKG01000036.1:1-99:+ AMKG01000004.1:3-83:+ AMKB01000005.1:3-62:+