Cluster: cluster_8763

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-F: 11, CAS-I-E: 1
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 100.0
Mean length of the directons containing the candidates 3.083333333333333
Percent of cluster members that occur in self-targeting genomes 91.67
Number of members in the cluster 12
Model score for cluster 0.64
Consensus sequence MARTTRPLTHTEVQKAKTTDKDLTLHDGDGLFLLVVTNGAIVIHTQRLKSDPGGNLLS
Accessions (where available) / Location AEL74473.1
AKS93144.1
AJI97394.1
AKS55768.1
AJK23469.1
AKS99096.1
AKS87891.1
AKS77937.1
AKS82290.1
EDR38619.1
CAL19753.1
EGI37751.1