Cluster: cluster_9095

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-C: 10, CAS-I-E: 1, CAS-II-C: 1, CAS-III-A: 1
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 63.64
Mean length of the directons containing the candidates 3.727272727272727
Percent of cluster members that occur in self-targeting genomes 10.0
Number of members in the cluster 11
Model score for cluster 0.4
Consensus sequence MNDTVPWVIVIPAWNETPQEQDKMRKLRVAAYCRVSTESEEQLSSYENQLSYYTEKIMKE
PG
Accessions (where available) / Location ERI65641.1
KGF56347.1
BCAC01000003.1:147652-147840:+
BAHQ02000040.1:14784-14972:-
EHO35903.1
BAHX01000002.1:27063-27203:+
BAHU02000030.1:52662-52802:+
EDP12433.1
ENZ13606.1
ENZ13470.1
ADJS01014459:2326-2454:+