Cluster: cluster_9282

CRISPR-Cas subtypes that co-occur with the candidate CAS-II-C: 10, CAS-III-B: 7
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 36.36
Mean length of the directons containing the candidates 4.272727272727272
Percent of cluster members that occur in self-targeting genomes 9.09
Number of members in the cluster 11
Model score for cluster 0.52
Consensus sequence MATIRETILKVKPGKQKIIPLSEVEVTGYRQEAHEINKELREKGVVAPGGKNVYTISKNK
YTNSMYIVNNMTK
Accessions (where available) / Location EKN33266.1
EXY63120.1
EIY45654.1
KFX73868.1
EYE43395.1
EIY48566.1
EYA65432.1
EGN04252.1
EXZ97797.1
EYA47408.1
EXY43479.1