Cluster: cluster_9465

CRISPR-Cas subtypes that co-occur with the candidate CAS-III-D: 11, CAS-I-B: 4
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 100.0
Mean length of the directons containing the candidates 5.0
Percent of cluster members that occur in self-targeting genomes 18.18
Number of members in the cluster 11
Model score for cluster 0.53
Consensus sequence MKSKILSAALVTAVLSSFAFGANDKAIELSNKIFAVKKDASAKELIIRDACFKIHNEMLE
VTKNMTPDQRDDFNKEFRMQMRKNMATLGKDEYFNPAVCRSVMKKHNRNYGMRNPGMGNP
GMGMGGGYNCQSNADCPYNQ
Accessions (where available) / Location AJMC01000035.1:66851-67273:+
JYCP01000014.1:41593-42015:+
AHE94222.1
ASTK01000016.1:65891-66313:+
AIR78759.1
AJSG01000040.1:89018-89440:+
AIR80531.1
ABK82434.1
CDF65061.1
ALV64859.1
AGZ81702.1