Cluster: cluster_1061

CRISPR-Cas subtypes that co-occur with the candidate CAS-II-A: 88, CAS-I-C: 7, CAS-I-E: 1
Percentage of cluster members that co-occur with known Acrs 3.8
Percentage of cluster members that are adjacent to an HTH protein 94.51
Mean length of the directons containing the candidates 4.967032967032966
Percent of cluster members that occur in self-targeting genomes 5.06
Number of members in the cluster 91
Model score for cluster 0.25
Consensus sequence MFEIDYSQAKEFASITDGTYETFVEKAVQDATKNGADFINIHFRIRKDFQQEFQNNIIFH
RIFAKKEDGKYPIGAIMNLAKQAGIPDGTKFKSLDDYLNQLLNKCLKITVKNETSEYNGN
TYNNLNVKRWEKSDIPTMVNPVEEFKEDDLPF
Accessions (where available) / Location JRZB01000001.1:504018-504581:-
JRYZ01000002.1:1721-2284:-
KEX86569.1
KHK30756.1
AKI49198.1
KXS73760.1
KSV56093.1
EZL46111.1
EZL26962.1
EZN05139.1
AAM79567.1
EZK56114.1
EZL95555.1
EZK70914.1
EZM02257.1
EZL58662.1
EZN35750.1
EZL36848.1
ESU94792.1
AWOZ01000001.1:47186-47644:+
KLL92129.1
EZL83188.1
EZM05795.1
EZL91213.1
EZL77533.1
EZM00681.1
AIG46815.1
EZK73145.1
EZL11638.1
EZK72836.1
EZL56565.1
EZM89566.1
EZL86632.1
EZL32635.1
EZL78123.1
EZL56878.1
EZL85356.1
ESU89916.1
KLL25246.1
EZK86886.1
AAM79949.1
EPZ46812.1
YP_009191515.1
EZL85921.1
EZK72451.1
EZN37823.1
EQL79423.1
EHI70671.1
EZL72337.1
AWPF01000017.1:9514-9972:+
EZL72722.1
EZL64689.1
EZL80446.1
EZL73613.1
EZK87271.1
EZK62102.1
EZL80831.1
ESA59277.1
EZN36134.1
BAC63988.1
ABF37794.1
AFC68357.1
EZK92824.1
AIG47176.1
AIW11666.1
EZL29307.1
EZL69334.1
EZK80136.1
ERL18986.1
EZL92910.1
EZK80522.1
CDEN01000064.1:3563-4021:+
EZN28858.1
ABF33874.1
EZL79588.1
AIL11537.1
EZL62122.1
EZL73766.1
BAC63617.1
EZL14883.1
EZN32496.1
EZL39969.1
EZK67308.1
EPT81709.1
EZL02879.1
EZN38574.1
EZK96275.1
EZL99475.1
EZL89098.1
EZL08714.1
LLVR01000041.1:48573-48878:+