Cluster: cluster_11057

CRISPR-Cas subtypes that co-occur with the candidate CAS-II-C: 4, CAS-III-B: 6
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 11.11
Mean length of the directons containing the candidates 3.222222222222221
Percent of cluster members that occur in self-targeting genomes 22.22
Number of members in the cluster 9
Model score for cluster 0.34
Consensus sequence MEIGAKVAFPKDRRKSVRTTASDIKTDEGKVFTTWIEDDKLFVKRNK
Accessions (where available) / Location BAKL01000051.1:30638-30823:-
EXZ29168.1
EYB01029.1
EYA05335.1
EYA00740.1
EXZ03081.1
EYE55532.1
EOA55611.1
EYA86119.1