Cluster: cluster_11313

CRISPR-Cas subtypes that co-occur with the candidate CAS-II-C: 8, CAS-II-A: 6, CAS-III-A: 7, CAS-I-E: 3
Percentage of cluster members that co-occur with known Acrs 12.5
Percentage of cluster members that are adjacent to an HTH protein 11.11
Mean length of the directons containing the candidates 2.555555555555556
Percent of cluster members that occur in self-targeting genomes 12.5
Number of members in the cluster 9
Model score for cluster 0.31
Consensus sequence MNASNLKNPEQYDEFVLALQKILIRFAIKMDSCLVAEEDGHIFSSYLQHQTVSMLDNLQN
GADQAFPFYKHY
Accessions (where available) / Location ETW91336.1
ADQ62495.1
AKB97052.1
AWVZ01000005.1:53734-53991:+
KPL37233.1
CCC19270.1
AKH34696.1
EFX95579.1
CCC19271.1