Cluster: cluster_1156

CRISPR-Cas subtypes that co-occur with the candidate CAS-II-A: 83, CAS-II-C: 3
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 98.82
Mean length of the directons containing the candidates 4.023529411764706
Percent of cluster members that occur in self-targeting genomes 27.71
Number of members in the cluster 85
Model score for cluster 0.33
Consensus sequence MGENLNSNIDPRIIFKQLPPATIIKGFVAGETKCNYEIYLLELLNKSVYFREKGKSKFHA
PEDESHGECDAVADDYKIDFKLLSSSSRLQASSLFSPSITNLGNGITAIGESRNPNGEIK
ATQIHAAFRFRTVSDLIRLKVKRQHVRKQCLEKDIIKVLNMLEKQKNLLLFFPYIFYTEE
EISTNELDDIILNAISYDFSSLFAYRHIKVQSFETYLLTIVRDEFNIFKISNKRLKLIEK
LSCSELPTFVKLKSYSI
Accessions (where available) / Location EPW93512.1
KLL70774.1
EPU57064.1
AUVQ01000018.1:3966-4739:-
AUVY01000014.1:3911-4684:-
AUWC01000007.1:42915-43688:+
EPW27206.1
CDEG01000034.1:42642-43415:+
EPU51677.1
EPU57468.1
EPU63224.1
EPX20104.1
CDDR01000016.1:3477-4250:-
EPX00849.1
KLL75954.1
EPV70938.1
EAO73656.1
EPW18620.1
AUVS01000018.1:3695-4468:-
EPV92494.1
AKI95055.1
AUVW01000015.1:42882-43655:+
KLL64201.1
AUWE01000002.1:42901-43674:+
AUWB01000020.1:147940-148713:+
KLK64971.1
AUWG01000001.1:88221-88994:+
KLJ73965.1
EPV45080.1
CDEP01000004.1:3449-4222:-
KLK23762.1
EPV16754.1
EPT90134.1
EPU69631.1
EPV75748.1
AUWA01000002.1:3646-4419:-
KLL18639.1
KLL44110.1
ATOQ01000131.1:2768-3541:+
EPU32873.1
EPW27918.1
AUVT01000015.1:82950-83723:+
KLK06597.1
EPU29269.1
CCW37492.1
AUWF01000007.1:3782-4555:-
JUUN01000050.1:3443-4216:-
EPX42557.1
CDCS01000019.1:42642-43415:+
JPOV01000001.1:1490338-1491111:-
KE376175.1:42600-43373:+
ANDT01000023.1:42126-42899:+
KLK26235.1
KLL48513.1
EPW09996.1
AUVX01000001.1:42798-43571:+
EPW35441.1
CCQ80172.1
KXA50157.1
CDCJ01000019.1:42642-43415:+
KE376180.1:42598-43371:+
AUVV01000018.1:42890-43663:+
AUWD01000006.1:3659-4432:-
ANQP01000022.1:65790-66563:+
KLK58766.1
EPU93455.1
EPW47740.1
AUWH01000002.1:42904-43677:+
JUTW01000021.1:3457-4230:-
EPT75693.1
KUH48211.1
EPW49950.1
AUWI01000021.1:42977-43750:+
AUVU01000008.1:42966-43739:+
KLL53055.1
KLL53148.1
AUVR01000013.1:82970-83743:+
EPV62612.1
ABA44818.1
ANQH01000017.1:47410-48183:+
EPX18008.1
EPX18009.1
EKB52710.1
AJG25939.1
EKB52707.1