Cluster: cluster_11702

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-E: 7, CAS-I-F: 2
Percentage of cluster members that co-occur with known Acrs 22.22
Percentage of cluster members that are adjacent to an HTH protein 33.33
Mean length of the directons containing the candidates 3.888888888888889
Percent of cluster members that occur in self-targeting genomes 11.11
Number of members in the cluster 9
Model score for cluster 0.19
Consensus sequence MGLCNNQFPPPAKRQSPRRLLINCQNSYSNIIKIGYVLAEYAAKARVVMHKTK
Accessions (where available) / Location EFE06135.1
KXB40508.1
KWZ98430.1
ESA73449.1
ESA89931.1
ESD29570.1
EFJ84436.1
EFU36025.1
EFJ73393.1