Cluster: cluster_11761

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-F: 5, CAS-I-E: 3
Percentage of cluster members that co-occur with known Acrs 11.11
Percentage of cluster members that are adjacent to an HTH protein 11.11
Mean length of the directons containing the candidates 3.7777777777777786
Percent of cluster members that occur in self-targeting genomes 44.44
Number of members in the cluster 9
Model score for cluster 0.61
Consensus sequence MMNWRDEIRGFDLDQLRNFRDFIGDLIARKEEEPRRTVWRVCDDWICYGNFREDDYLKAV
DFLAEKAKERNADPDSDRRDMRMEILSQRVPESEYEGWFD
Accessions (where available) / Location KTG25436.1
NP_892080.1
KNZ83169.1
KGZ25424.1
CDK64362.1
KFD04276.1
ESN44147.1
AKL28105.1
ALR24129.1