Cluster: cluster_1182

CRISPR-Cas subtypes that co-occur with the candidate CAS-III-A: 84
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 59.52
Mean length of the directons containing the candidates 3.190476190476192
Percent of cluster members that occur in self-targeting genomes 24.32
Number of members in the cluster 84
Model score for cluster 0.43
Consensus sequence MDPGELQMVVRPKTPRGDGNWVSLTGMALVLVVVRPKTPRGDGNSERWKGWGHVRWFSDP
KPAGGAETQ
Accessions (where available) / Location KBB37462.1
KBV92477.1
KCA03569.1
AMC51850.1
KCA90567.1
AMC65161.1
KBU07900.1
AMC60531.1
KCM71896.1
KCQ80908.1
KBX57466.1
KXN95925.1
KBM15758.1
KCK72981.1
KCL16186.1
KBX33076.1
KBK51597.1
KBY27138.1
CM002102.1:486159-486329:-
KCN06203.1
KCI01634.1
KCQ34294.1
KCJ80491.1
BAQ06382.1
KBD69833.1
KBD70107.1
KCT88105.1
KCS37972.1
KCS07063.1
KCS87344.1
JUFH01000058.1:2-145:+
KCP27352.1
KCO36268.1
KEC90259.1
KBJ81665.1
AMC82668.1
KCR50561.1
KCP27349.1
KBI08191.1
KBJ03966.1
KBR85196.1
KBG39358.1
KBX40469.1
KBH82293.1
KBR36259.1
KBG29266.1
KBN31092.1
KCM36162.1
KCO60347.1
KBV72709.1
KCJ24808.1
KBY26192.1
KBV92476.1
KBV72710.1
KCJ24809.1
EFD48401.1
KCO04492.1
KCO95806.1
EFP29881.1
KAY47350.1
KBF56206.1
EFP22709.1
KBJ76995.1
KBL79306.1
KBJ77001.1
AMC47268.1
AMC43042.1
KAZ01716.1
KCM72252.1
EFD48398.1
KBE08167.1
KBR76981.1
KCU07366.1
KAY47373.1
KAR87635.1
KAU22812.1
KBF12706.1
KBB58481.1
KBZ49712.1
EFD48403.1
KBI87056.1
KAW57243.1
KCA90568.1
AMC65162.1