Cluster: cluster_11956

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-E: 9
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 11.11
Mean length of the directons containing the candidates 4.111111111111111
Percent of cluster members that occur in self-targeting genomes 50.0
Number of members in the cluster 9
Model score for cluster 0.54
Consensus sequence MENITILPKGGRLSSKMRRYLERGNLITHHRLEEHIRQSEIKALENIIDQAFGVETEPRK
VLTLQRKPQNDGVNVIANLIVQVKGDENEPQDSFNNCCMSDVALYSTKQRAGNRILESGG
VTARG
Accessions (where available) / Location CDG99829.1
CDG91051.1
CDG21030.1
KLU15019.1
KOP35161.1
CDH33269.1
CDH00180.1
CDH30048.1
CBJ80316.1