Cluster: cluster_1302

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-C: 3, CAS-I-E: 54, CAS-III-B: 4, CAS-I-C, CAS-III-B: 2, CAS-I-U: 5, CAS-I-B: 11, CAS-III-D: 8, CAS-III-D, CAS-I-B: 8, CAS-III-D, CAS-III-D: 2, CAS-IV-A: 8
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 15.58
Mean length of the directons containing the candidates 3.74025974025974
Percent of cluster members that occur in self-targeting genomes 24.14
Number of members in the cluster 77
Model score for cluster 0.41
Consensus sequence MAIQGRIPVSFGDVFPHGAFVVGVEPVNDFDKSRAGNKVQARDKDTGLPVWQVEVLDADP
EARKKSKEVKVKIAAEVQPVPPDAVPGLPFRPVEFDGLTVTPYVDDNGRRPRIAYSFRAR
GMRAPGAGKSRAAASKDAA
Accessions (where available) / Location JADG01000019.1:166467-166910:+
JADG01000008.1:291131-291568:-
BCQT01000002.1:511114-511527:-
ANAZ01000041.1:65117-65551:-
LAJC01000023.1:40820-41242:+
ANAS01000033.1:141982-142404:-
ANBH01000388.1:4735-5157:+
BCRK01000160.1:1606-2028:-
ANAS01000005.1:557052-557474:+
LAJC01000008.1:55358-55780:-
AZXF01000005.1:311101-311514:+
AZXF01000024.1:40831-41244:-
LAJC01000016.1:76415-76828:+
ADH70667.1
KB906872.1:59217-59627:+
LEKI01000007.1:65833-66243:-
ANBA01000027.1:68324-68731:-
ANBF01000148.1:30837-31244:+
ANBE01000003.1:306267-306674:-
BCRR01000042.1:9079-9483:+
LAVM01000010.1:79557-79961:-
ANAZ01000002.1:314799-315203:+
ANAZ01000003.1:10715-11116:-
KUP97333.1
AEB42041.1
KUJ47577.1
ALG05849.1
JNYM01000284.1:7057-7470:-
AXWW01000030.1:43899-44261:+
KI912266.1:7938600-7939013:+
KI912267.1:1333442-1333855:-
KI912266.1:777159-777569:+
KQM04756.1
KJE21501.1
ABW14687.1
CAJ64081.1
CAJ60383.1
KJE20054.1
KQM02351.1
KQC35714.1
ETA03997.1
KFB06895.1
ACU77375.1
KWW97924.1
JODS01000019.1:133699-134094:-
JAIZ01000170.1:12233-12628:-
KL575976.1:3544-3939:-
KWW98049.1
BBID01000030.1:5922-6308:-
JOEP01000001.1:561280-561711:-
BBXF01000002.1:1494576-1495007:+
KB903945.1:83865-84293:+
BBXF01000002.1:308490-308915:-
KL573129.1:14802-15224:-
BCBX01000051.1:68221-68637:-
BBYK01000039.1:353998-354411:-
BBYK01000044.1:103130-103540:-
KB904001.1:1698-2123:+
KL574407.1:136897-137322:-
BBYL01000044.1:38125-38541:+
BCQP01000056.1:74100-74507:+
BCBX01000051.1:3640-4056:+
BCRI01000261.1:3274-3582:-
BCRI01000103.1:24354-24653:-
ERS30411.1
ERS23729.1
BAK37966.1
BAK37951.1
KRQ67236.1
KRQ47917.1
ETW21555.1
KRQ44989.1
KRQ24608.1
KRQ37462.1
KRQ82383.1
KRQ83185.1
KI912270.1:3890114-3890533:+