Cluster: cluster_13231

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-E: 8, CAS-I-F: 1
Percentage of cluster members that co-occur with known Acrs 62.5
Percentage of cluster members that are adjacent to an HTH protein 62.5
Mean length of the directons containing the candidates 4.375
Percent of cluster members that occur in self-targeting genomes 12.5
Number of members in the cluster 8
Model score for cluster 0.5
Consensus sequence MMKKWLFCLVGVIFSCSALAQTEEQAQKELKRYQDMKPQVEQMLRESGKLYYDMPDAASE
YHQGNPEEWRNIFNGLKQLDEQAEKLGDDPLDPVYGSCVNMKNQLQDYWSNVIGDDRQFL
ERSRNQFKENRMDCFDSFVFGKERIESRKDLAIVNVWDMTK
Accessions (where available) / Location KLG59873.1
KNF71135.1
KLG69606.1
AEJ56016.1
BBVE01000014.1:101890-102366:+
EII43971.1
AIAS01000034.1:27669-28145:+
ESG05632.1