Cluster: cluster_1383

CRISPR-Cas subtypes that co-occur with the candidate CAS-II-A: 69, CAS-I-C: 8, CAS-II-C: 2, CAS-I-E: 1
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 72.22
Mean length of the directons containing the candidates 4.805555555555554
Percent of cluster members that occur in self-targeting genomes 28.79
Number of members in the cluster 72
Model score for cluster 0.23
Consensus sequence MMTPNELAERINSTTLSEAIEIFEEKILMMSLKNYDDNQYRQGVQKEYKRIDYDGSFFFF
VEPDLGSSRGGLSDCIETEQEKIALLLLLVEAYDRYVDVNVGIEDWLGYDCIFCDFVVSN
ESAAKPLTQTEYEVIRDLIVMIIDNYVPSMTVMETWEYETFKQGQNPNTTRIDNVQITLP
LFDKQEK
Accessions (where available) / Location KEH51290.1
KLK13266.1
KLL31526.1
EPW70116.1
EPW98196.1
ANPW01000038.1:8604-9167:-
EPV92028.1
KE376141.1:35687-36250:-
ANPY01000003.1:5313-5876:-
EPX06430.1
KLL34249.1
KLJ34488.1
KLL79189.1
ANQA01000055.1:2915-3478:+
EPT47850.1
CAD46782.1
KLK16985.1
ANQA01000008.1:2915-3478:+
ATOY01000018.1:35688-36251:-
ANCL01000118.1:19017-19580:+
ANQQ01000024.1:36002-36565:-
EPV89419.1
KLL21832.1
KLJ52964.1
EPT56559.1
BAM61613.1
ANPY01000068.1:19158-19721:-
ANPY01000002.1:37516-38079:-
EPV58472.1
EPV05043.1
KLJ75726.1
ATOZ01000020.1:9297-9860:+
EPT36672.1
EPU20339.1
ATPB01000252.1:4843-5406:-
KLK70715.1
EGS27555.1
ANPS01000038.1:8604-9167:-
ANQB01000010.1:123033-123596:+
ANQF01000022.1:13145-13708:-
KLK77193.1
ANPX01000028.1:18698-19261:+
KLJ89628.1
KLJ82687.1
EPW35894.1
EPT37030.1
EPV83248.1
ANDC01000024.1:18863-19426:+
EPW51792.1
EPW43156.1
ANPV01000062.1:19146-19709:-
CDEO01000006.1:11733-12293:-
KLK65958.1
KLK14194.1
EPX28069.1
ANQW01000027.1:151212-151772:-
JUQU01000055.1:49475-50035:-
AIX04174.1
EPT76431.1
KLD90112.1
EPT66564.1
ANQW01000017.1:4165-4725:-
KXA56440.1
EHI68923.1
EPU47856.1
KLL90298.1
ANQW01000006.1:28660-29220:+
EPW53812.1
EPW14355.1
ANQW01000028.1:4165-4725:-
EPV89188.1
ANPR01000011.1:3-326:+