Cluster: cluster_1398

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-C: 39, CAS-V-A: 1, CAS-III-D: 9, CAS-II-A: 7, CAS-I-B: 16, CAS-I-A: 7, CAS-I-F: 2, CAS-II-C: 1, CAS-I-B, CAS-III-D: 1, CAS-I-C, CAS-I-B: 1, CAS-III-A: 4, CAS-I-E: 2, CAS-III-B: 2, CAS-III-A, CAS-III-D: 2, CAS-III-D, CAS-I-C: 2
Percentage of cluster members that co-occur with known Acrs 1.56
Percentage of cluster members that are adjacent to an HTH protein 79.17
Mean length of the directons containing the candidates 4.444444444444446
Percent of cluster members that occur in self-targeting genomes 21.88
Number of members in the cluster 72
Model score for cluster 0.52
Consensus sequence MMDPYENLANAIILQAVKDYREALKRLKKNPRNKSAQAEKREIERFFRSDWFNVLTSIDG
EMLIRKLQEEVAQ
Accessions (where available) / Location AUJX01000031.1:36848-37183:-
JNJM01000040.1:5704-6018:+
EDY32065.1
ERK50315.1
EJU26361.1
BBCG01000013.1:33233-33514:+
BABR01000063.1:77567-77797:-
ADL53655.1
KB911068.1:149958-150185:+
ENZ13251.1
CUH97180.1
AEY67726.1
JNJN01000033.1:21452-21676:+
ADU27349.1
LAGG01000243.1:75419-75640:-
KNF08424.1
ETA80550.1
ERT57149.1
ACL77141.1
CCFJ01000014.1:77090-77311:-
CFX32179.1
CCNM01000014.1:77090-77311:-
KI783301.1:2943359-2943580:-
HE978514.1:178605-178826:-
ERI11260.1
KUK65632.1
KOA19569.1
CFX07283.1
JNJJ01000024.1:17241-17462:-
LN868935.1:350068-350289:-
CCFE01000031.1:109850-110071:-
JHVC01000011.1:125331-125552:+
KEF36973.1
KAJ50645.1
KEF39686.1
EDK34667.1
KOY81830.1
KB908410.1:827-1054:-
ETA80599.1
KKF49402.1
LN874944.1:341888-342109:+
CDM68563.1
AUJR01000046.1:19593-19814:-
EHL65436.1
CDE03519.1
CDA71328.1
CCY43161.1
KOA21164.1
EMZ33086.1
ATWA01000022.1:10552-10779:-
KGP77229.1
AEV30600.1
JNLK01000001.1:2251141-2251341:+
EFR90479.1
CUL88512.1
AUEG01000001.1:483050-483271:-
JHVL01000019.1:44311-44532:-
ABR50127.1
EFR41069.1
EKX96734.1
AUFU01000015.1:33507-33722:-
EJO21965.1
EFR40341.1
EJP31951.1
AUFU01000017.1:30945-31157:-
EGK59354.1
EKY01103.1
EHG24923.1
EFM24285.1
EHG25148.1
CUX74435.1
CBL34289.1