Cluster: cluster_1465

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-B, CAS-III-B: 1, CAS-I-C: 44, CAS-I-E: 9, CAS-I-B: 5, CAS-III-D: 6, CAS-II-A: 4, CAS-III, CAS-I-C: 1, CAS-II-C: 6, CAS-III-A: 3, CAS-III: 2, CAS-III-D, CAS-I-C: 1, CAS-I-C, CAS-III-D: 2, CAS-VI-A: 1
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 98.53
Mean length of the directons containing the candidates 2.264705882352941
Percent of cluster members that occur in self-targeting genomes 23.53
Number of members in the cluster 68
Model score for cluster 0.24
Consensus sequence MAKNKTEIHVTTVFDGELDATDVFVSLISQKYGKTNTKEYLAKKKDLKYNEDEVQKSQIP
SGLCG
Accessions (where available) / Location BAHW02000027.1:248367-248627:+
LN913006.1:2769153-2769371:-
ENZ00570.1
EMZ25576.1
EMZ20228.1
EOS70783.1
JPJD01000048.1:9840-10037:-
EGN48247.1
EOS31882.1
EFE13566.1
EDO57441.1
EEG95031.1
CBK77891.1
BAID02000015.1:19532-19729:+
LN869529.1:1325763-1325960:-
EEU99507.1
CBL01703.1
CBL00495.1
LN913006.1:653901-654098:+
AEN98189.1
EOS29811.1
ADJS01009758:2262-2471:-
EGN49709.1
ENZ05327.1
EOS56030.1
EDM97595.1
ENY83755.1
ENZ05020.1
EOS33306.1
EDP11848.1
EHL71628.1
ENZ66612.1
EDN78898.1
EEG88541.1
EGN33707.1
EOS33694.1
EEG93195.1
ENZ09705.1
EGA94047.1
EGB18163.1
EEF66514.1
ERI96149.1
LN913006.1:676692-676889:+
EOS77742.1
ETD20443.1
AEN95491.1
EFQ05735.1
ENZ52923.1
EDP21209.1
EFE14226.1
BAIH01000021.1:29394-29591:+
EOS22045.1
EDP22865.1
ENY99577.1
ERJ96269.1
EEX21985.1
EHF07371.1
CBK77661.1
CDND01000001.1:1509414-1509611:-
EEA82265.1
ACR76438.1
ENZ59322.1
ENY84626.1
JPJD01000038.1:8263-8460:+
ACR74573.1
CRL32101.1
EDP20532.1
LN908964.1:255836-256033:+