Cluster: cluster_1510

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-C: 66
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 96.97
Mean length of the directons containing the candidates 2.060606060606061
Percent of cluster members that occur in self-targeting genomes 2.0
Number of members in the cluster 66
Model score for cluster 0.32
Consensus sequence MHTIELSKLVEQQLVLLQPERLEVIGLMRNGWEMALRVRPGLAPTCWLEKNEIGSGGESK
SVDIETFNVLVDRGVFRVKNIGCRVNIYALSDAYCLADELSP
Accessions (where available) / Location CEL49474.1
AJZ06616.1
JPLO01000016.1:3823-4131:-
CEE80246.1
AJY93386.1
CEE56832.1
CEE24221.1
CEF22766.1
CEE55251.1
JPLP01000016.1:3826-4134:-
CEH38966.1
AJY80070.1
CEI36758.1
CEL40765.1
CEG15283.1
AJZ15556.1
CEH84026.1
CEL35671.1
CEE65056.1
AJZ24363.1
CEH97461.1
CEE17075.1
AJY84492.1
CEE52181.1
CEE29014.1
AJD66489.1
AJZ28821.1
AJY93345.1
CEI03652.1
CEE55204.1
AJD66534.1
CEE27890.1
AJY97810.1
CEF34920.1
AJZ11127.1
AJZ24406.1
CEH81871.1
AJY84450.1
AJY88872.1
AJZ11084.1
CEE25866.1
CEH98675.1
AJZ37754.1
CEE17529.1
AJZ28782.1
AJZ19937.1
AJY80028.1
AJZ02193.1
AJZ06655.1
AJZ33285.1
AJZ33246.1
CEE44602.1
AJZ37715.1
AJZ19980.1
JPLN01000016.1:3826-4134:-
CEH90075.1
AJY88912.1
CEF43481.1
CEI18277.1
AJY97769.1
AJZ15513.1
AJZ02234.1
GG699305.1:3056-3355:-
KFA29308.1
CEG14705.1
CEE61981.1