Cluster: cluster_15355

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-B: 7, CAS-V-A: 4, CAS-III-A: 4
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 42.86
Mean length of the directons containing the candidates 2.8571428571428568
Percent of cluster members that occur in self-targeting genomes 42.86
Number of members in the cluster 7
Model score for cluster 0.19
Consensus sequence MQDVIENLKRKDEKIYITFNHFPEEFRKEERIMNSVRNLNYEYTEKFIIYNDKLEIHNPN
LNKLTLDSLNHNFLYRRIFELVYKKISERMIITEICLDDWYIKDEENIILYRYKSFEYSK
IYCNSRWYQGKIIHFCLDKRCNGELEIDFESFWKNNTSKYLCVYKCNKCGKFINAVDLIE
YMEQHEE
Accessions (where available) / Location ATKD01000086.1:20452-21015:+
EJU07435.1
ATKE01000060.1:7436-7999:-
EKA94118.1
ALF21079.1
ALQ40923.1
ATKF01000105.1:7436-7999:-