Cluster: cluster_1545

CRISPR-Cas subtypes that co-occur with the candidate CAS-II-A: 51, CAS-II-C: 2, CAS-I-B: 50
Percentage of cluster members that co-occur with known Acrs 84.38
Percentage of cluster members that are adjacent to an HTH protein 7.69
Mean length of the directons containing the candidates 4.523076923076923
Percent of cluster members that occur in self-targeting genomes 79.69
Number of members in the cluster 65
Model score for cluster 0.53
Consensus sequence MEEYVNISLDKYERLKMFENDKYEKDAKEFLKKFTNFTTIFGNQNEEYYTAHVNKEELKK
LIEQRLGKTCEIEFY
Accessions (where available) / Location KHK24700.1
AARK02000047.1:12482-12712:-
AKI43521.1
CUL27972.1
AKI40159.1
CUL84109.1
CWLM01000024.1:98936-99163:-
CUK90577.1
CDM19842.1
KES29665.1
CDN69716.1
KKD46827.1
EZH70287.1
KEU52791.1
JRZA01000001.1:20361-20588:-
CWKX01000022.1:20917-21144:-
CUL24439.1
EXL14709.1
CWMS01000094.1:8845-9072:-
AHJ05752.1
EXL24509.1
KID24126.1
CWLV01000072.1:1586-1813:-
CUL56321.1
CUL13876.1
CWMB01000003.1:20524-20751:-
KKB88932.1
KID15753.1
CAC97811.1
CWLY01000024.1:20576-20803:-
CWMV01000065.1:10685-10912:+
KEX45709.1
KEX42101.1
CWLB01000114.1:1565-1792:+
CWKW01000013.1:46612-46839:+
CUL66080.1
CUL49101.1
KEX11247.1
CWLH01000055.1:22129-22356:-
CWMF01000007.1:20745-20972:-
CWMR01000087.1:1095-1322:-
CUL47774.1
KID23045.1
EFK40207.1
CWKM01000028.1:10411-10638:+
CWLE01000068.1:12080-12307:+
CWMA01000122.1:9911-10138:-
CWMJ01000139.1:469-696:-
CWLD01000035.1:10466-10693:+
CWMM01000039.1:9973-10200:+
KEX50395.1
CUM04260.1
KTA32256.1
AGR27477.1
CWNC01000052.1:2122-2349:+
CWMQ01000076.1:1546-1773:+
CWLK01000032.1:24121-24348:-
KTA66776.1
CWMD01000099.1:9993-10220:-
AKI52035.1
KES36165.1
CWNG01000140.1:885-1112:-
CWLC01000028.1:9667-9894:-
AGR03092.1
CWMA01000114.1:3-152:-