Cluster: cluster_1579

CRISPR-Cas subtypes that co-occur with the candidate CAS-II-A: 57, CAS-I-C: 5, CAS-II-C: 4, CAS-I-E: 5, CAS-III-A: 5
Percentage of cluster members that co-occur with known Acrs 10.17
Percentage of cluster members that are adjacent to an HTH protein 71.43
Mean length of the directons containing the candidates 4.365079365079366
Percent of cluster members that occur in self-targeting genomes 25.42
Number of members in the cluster 63
Model score for cluster 0.67
Consensus sequence MLQDEFRPIPHKVLTIGRSPKESVIAIPKAIFNLPPEEKAQALKELEEDMEQHKAKGG
Accessions (where available) / Location KLL32050.1
KLJ52987.1
KLL21855.1
EPW35869.1
ANPT01000145.1:1294-1479:-
ATPB01000056.1:11557-11742:+
EIQ82431.1
KLL35934.1
EPX06455.1
CDCN01000020.1:33516-33701:+
KLK71681.1
ANQB01000010.1:98297-98482:+
EPU20313.1
KLL52566.1
KE376206.1:68273-68458:+
ATOY01000018.1:60947-61132:-
KLK65934.1
CDCP01000006.1:4593-4778:-
KLL51864.1
EPV58497.1
CAD46807.1
EPW98460.1
EGS27580.1
EPW49624.1
EPT54055.1
KLL48574.1
KLL36633.1
ANDC01000022.1:97959-98144:+
EPT63171.1
EPT49136.1
KLL51158.1
ANQA01000002.1:9297-9482:+
KLJ75744.1
KE376141.1:60946-61131:-
EPU64365.1
EPV05068.1
EPW70135.1
ANQQ01000024.1:61261-61446:-
KXA56464.1
EHI70699.1
JWGS01000022.1:40288-40515:+
ALYX01000022.1:264351-264578:-
EMC59262.1
JWGO01000034.1:26458-26685:+
EMB67399.1
EMC59821.1
EMC14304.1
CBZ48567.1
CBZ49235.1
CBI12757.1
KEQ36560.1
EFM34906.1
EKS18347.1
KXT80346.1
KEQ34365.1
JVJI01000125.1:55324-55491:-
KXT59307.1
JVMU01000040.1:56697-56864:-
EGL85569.1
JVNG01000025.1:56697-56864:-
EIC76225.1
EFU63489.1
CCW40276.1