Cluster: cluster_1749

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-F: 15, CAS-I-E: 43, CAS-II-C: 1, CAS-III-D: 1
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 47.46
Mean length of the directons containing the candidates 3.084745762711865
Percent of cluster members that occur in self-targeting genomes 5.08
Number of members in the cluster 59
Model score for cluster 0.52
Consensus sequence MTLYEILKTQFGTNAAIGRRFPRKGRPRGSQGVGKWKTRGVPEDVAILCHLDPNIPYTHP
PLANGEDDKPTHDQQ
Accessions (where available) / Location CBKR010000182.1:18454-18750:-
CAH21030.1
AHK20980.1
KGA61160.1
AJJ55835.1
CCPS01000016.1:5572-5781:-
LK985428.1:121759-121968:-
LM996539.1:752911-753120:+
LM996841.1:373401-373610:-
CCVO01000017.1:5348-5557:+
KDV31202.1
ELE54620.1
CCQV01000125.1:142003-142212:+
JAJC01000002.1:87628-87867:+
AJYD01000005.1:231376-231663:-
EOU75002.1
EQZ58994.1
EOW36333.1
ELD90731.1
EOW31241.1
EQN82800.1
KHI96917.1
JSMA01000447.1:4174-4401:+
LAIG01000235.1:6511-6738:-
ESD48362.1
EQY21765.1
JUKQ01000129.1:7168-7395:-
JSPS01000153.1:14254-14481:-
ELD82192.1
JXVW01000069.1:14543-14770:+
JICC01000087.1:7979-8206:-
JSQQ01000165.1:153172-153399:+
AEJX01000075.1:45949-46176:+
KIG79356.1
JHRY01000004.1:7720-7947:-
ELD87011.1
KLG50809.1
JSNS01000139.1:155319-155546:+
KOZ03207.1
KN714377.1:9391-9618:-
EOV26948.1
JICD01000068.1:8542-8769:-
JICB01000249.1:3861-4088:+
KHJ12685.1
JXVV01000006.1:216096-216323:+
NP_543064.1
EQW18834.1
JHRE01000090.1:8420-8647:-
CCQX01000137.1:12073-12300:+
EQO49971.1
AURV01000069.1:6526-6753:-
EIG48221.1
CDOT01000129.1:1144-1341:+
CDNT01000129.1:1144-1341:+
EMP49774.1
CDK67794.1
KUI98644.1
AKJ41533.1
KFK98108.1