Cluster: cluster_17942

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-E: 5, CAS-I-F: 3
Percentage of cluster members that co-occur with known Acrs 16.67
Percentage of cluster members that are adjacent to an HTH protein 66.67
Mean length of the directons containing the candidates 3.0
Percent of cluster members that occur in self-targeting genomes 16.67
Number of members in the cluster 6
Model score for cluster 0.2
Consensus sequence MKQFHDGISSKTFKKEYSGLCINWIDLIGAVVFGLVISINF
Accessions (where available) / Location EMX53421.1
EMV25472.1
AICC01000176.1:6981-7106:+
EMZ67010.1
JSOL01000060.1:41508-41633:-
LBBN01000043.1:20219-20344:+