Cluster: cluster_18035

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-C: 1, CAS-II-A: 4, CAS-I-E: 1
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 33.33
Mean length of the directons containing the candidates 1.5
Percent of cluster members that occur in self-targeting genomes 0.0
Number of members in the cluster 6
Model score for cluster 0.35
Consensus sequence MKENTMKVLAAWFLGLGTFVTTQVGQSADQTTSMYRLYNPHSGEHFYTASTTERDNLIRA
GWHDEGVGWVAPLSGNPVYRLYNPNSGDHHYTMSGYEAQHLVKRGWKWEYIGWYSGGTVP
VYRLYNPNARTGTHHYTMNAGERDSLINVGWRYGGTAWNAVGNGNGNGGTNYNSPVANHN
SPTNSSSGSTDGYNPDGMVFNNRNWDYDDGWYRIENMPYNTNFNGSYLMGYANYINS
Accessions (where available) / Location NP_116525.1
AQYA01000037.1:165248-166006:+
CP010059.1:220468-220971:+
KFI86055.1
CBZ48579.1
BAK28236.1