Cluster: cluster_1956

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-C: 31, CAS-II-C: 6, CAS-III-D: 17, CAS-III-A: 5, CAS-I-B: 14, CAS-II-A: 3, CAS-III, CAS-I-C: 1, CAS-III-D, CAS-I-B: 1, CAS-V-A: 1, CAS-III-A, CAS-I-C: 1, CAS-I-E: 3
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 11.32
Mean length of the directons containing the candidates 2.339622641509434
Percent of cluster members that occur in self-targeting genomes 26.19
Number of members in the cluster 53
Model score for cluster 0.46
Consensus sequence MTAMDLENMKNVDIRTVDPEELVDIRDVKVDRNLPREERIRDFIRQIKNPYCFRCGNMVV
KVSFADNGVTLEECLENYLRSM
Accessions (where available) / Location EEG95429.1
ERI75107.1
ADJT01007925:5047-5313:-
ADJT01007925:5310-5549:-
ERI75108.1
EOS33827.1
EMZ27045.1
EOT24406.1
BBZX01000001.1:272794-273033:-
KGJ51429.1
JHWJ01000031.1:4938-5195:-
BAHY01000023.1:69167-69424:+
BAHR02000007.1:36915-37172:+
EMZ37917.1
EDM51121.1
JPJF01000091.1:7445-7660:+
EGN48286.1
BBZP01000022.1:18353-18679:-
EMZ36987.1
BBZQ01000064.1:6507-6764:-
EFC99407.1
BAHY01000014.1:19476-19733:+
BAHR02000002.1:14917-15174:+
KJS20509.1
KB911069.1:110436-110714:+
KJR46165.1
KJS86657.1
EHO32213.1
KJF39130.1
EDM99043.1
JNLK01000001.1:468565-468804:-
EMZ26158.1
EMZ17515.1
CDB26815.1
EOS62332.1
EHO31480.1
EOS49561.1
EMZ12408.1
EMZ12129.1
EOS76629.1
EMZ22456.1
ADJT01013086:3730-3978:-
CCK94242.1
ADJS01020690:5107-5355:-
BBZQ01000066.1:8419-8667:-
CRL39875.1
EFH07414.1
ENZ58211.1
CBK93863.1
ETD19459.1
ACR77256.1
ADJT01013295:3729-3977:-
CCK87143.1