Cluster: cluster_1993

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-E: 52, CAS-I-F: 7
Percentage of cluster members that co-occur with known Acrs 10.0
Percentage of cluster members that are adjacent to an HTH protein 11.54
Mean length of the directons containing the candidates 2.5
Percent of cluster members that occur in self-targeting genomes 18.0
Number of members in the cluster 52
Model score for cluster 0.23
Consensus sequence MRRPDKRQQRRAVPRRHPRKHQRRQAVRRRHLRAKLLLNPRQRVPRQRQNGQRILHMPWR
WRMRARRKRGW
Accessions (where available) / Location ENC35111.1
EMX20966.1
EMV76484.1
EMV77363.1
ENA22373.1
EMW22401.1
EMW06059.1
ENE14505.1
EMV40913.1
EMV48135.1
KEM42115.1
KEJ45339.1
KDT80714.1
KDU46683.1
KDU31993.1
KEL39226.1
KDU42944.1
KEN31390.1
EMX25739.1
KDV60125.1
EMX76045.1
KEN07367.1
ENG63402.1
EMX73215.1
EMW68921.1
KEM32246.1
EIQ49077.1
ENA53167.1
EMZ85881.1
EMV95164.1
KEM15856.1
KDU19894.1
KDY84229.1
EII10249.1
ERC21253.1
KEN66401.1
EHW82697.1
KEL46144.1
ELV85439.1
EHX79631.1
END33952.1
KDZ86223.1
ENE95299.1
ENE26313.1
ENE43688.1
ENG07527.1
ENG23282.1
ENG22868.1
ENE26089.1
EMX16080.1
EMW27037.1
ENE51579.1