Cluster: cluster_1998

CRISPR-Cas subtypes that co-occur with the candidate CAS-II-A: 49, CAS-I-C: 5, CAS-II-A, CAS-III-A: 1, CAS-III-D: 1, CAS-III-A: 4, CAS-I-E: 2
Percentage of cluster members that co-occur with known Acrs 10.87
Percentage of cluster members that are adjacent to an HTH protein 50.0
Mean length of the directons containing the candidates 4.134615384615385
Percent of cluster members that occur in self-targeting genomes 17.39
Number of members in the cluster 52
Model score for cluster 0.42
Consensus sequence MTDNRFAQLKENFEKEPPKRRVPTPRKQAAQKAPESYNKKGRYPFSLHHDVRYDKLEELV
EYHGAKSASDYLEKLIIQEWEKMQRKLKN
Accessions (where available) / Location AGS05462.1
BAK29008.1
EWC99346.1
CAD46381.1
ANQH01000019.1:391955-392233:-
EPU31038.1
CAD46051.1
EPV22488.1
ANQP01000014.1:145123-145401:-
EUB12523.1
EPU34311.1
EPX14286.1
EPX05979.1
EIQ81693.1
KLJ42650.1
ANQG01000009.1:26842-27120:+
KLJ77364.1
EPT73213.1
EPU38320.1
KGM37018.1
CAD46631.1
KLJ25797.1
KLJ57393.1
ETD05979.1
EPX11825.1
LSJE01000107.1:63870-64142:+
EMC62628.1
CQR25124.1
EPX07443.1
EGS27988.1
ANQB01000013.1:204969-205238:+
KLL92869.1
KLL81632.1
KEQ49613.1
JVMU01000018.1:56696-56968:+
EPV37565.1
KLK31903.1
EKS16037.1
JVJI01000110.1:111280-111552:-
EFM36002.1
JVNG01000036.1:234680-234952:-
EIC78887.1
KB904459.1:35397-35675:+
EPX14760.1
EIQ80851.1
EGS28470.1
EGS26832.1
ALND01000006.1:149022-149294:+
KIS19091.1
EPT35489.1
ETS97695.1
EFU21413.1