Cluster: cluster_2025

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-E: 38, CAS-II-C: 17, CAS-I-E, CAS-II-C: 1
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 94.23
Mean length of the directons containing the candidates 1.942307692307692
Percent of cluster members that occur in self-targeting genomes 23.08
Number of members in the cluster 52
Model score for cluster 0.62
Consensus sequence MADKHPIFHDVERRPIAATVVEENGTPVLALDQIAEDGSTRRILTLNKFDAKQLSAACDR
YLHQQNSIDFANVNTLLTEVDRANLYGDEDD
Accessions (where available) / Location AJGI01000001.1:295968-296300:-
CAE49337.1
JPUV01000001.1:1112836-1113126:-
AKS12973.1
AFK16274.1
KEX88611.1
AEG81208.1
AHI22255.1
AIT88666.1
AMN75749.1
AIU32265.1
KPH84330.1
AEG83397.1
KKO85568.1
ESU58314.1
AMN72937.1
KPH77236.1
ALD94440.1
AKA96228.1
AIU91308.1
AKN76599.1
KPJ24682.1
AIU30032.1
AFH90458.1
BAM26981.1
JNKV01000032.1:13067-13345:-
KLN40656.1
ERA57238.1
AEX82970.1
AEX80735.1
AEX46015.1
EIK56298.1
CKG79286.1
KLN39618.1
KLN44690.1
AEX71728.1
AEX43802.1
AEX66939.1
ERA53402.1
KKA80719.1
AEX76229.1
AEX73987.1
AEX78465.1
AEX48303.1
KJJ60897.1
AEX69449.1
AEX41511.1
AKE41869.1
AQUW01000002.1:283683-283964:-
AJE66866.1
ALC05293.1
AKK05295.1