Cluster: cluster_2144

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-E: 45, CAS-I-C: 5, CAS-I-B: 6, CAS-I-U: 10, CAS-III-D: 2, CAS-I-C, CAS-III-B: 1, CAS-III-D, CAS-I-B: 1
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 83.67
Mean length of the directons containing the candidates 4.775510204081633
Percent of cluster members that occur in self-targeting genomes 47.06
Number of members in the cluster 49
Model score for cluster 0.26
Consensus sequence NPDPRPGSRAARMRMPLARDVVEAVAVEHGVCVRPVAMRRTDLDTGETEIIDVPCGATLA
SKCPPCAERARRLRMAQCREGWHLDDEPVPDPDPPSDEQRALVALRADLEAARDEAERDG
DPDGVDEIDEVIGEVDEELNATGVRGRLAPDDRSDRPRRVRSTRRRQDAPDLPRRPVERR
TVGRTYTAADGKTYRPSMFLTLTLDSYGRVNSDGTPVDPASYDYRRAARDAIHFPKLIDR
FWQNLRRCVGWDVQYFAAVEPQRRLAPHLHMAIRGTIPRAILRQVAAATYHQVWWPPADQ
PVYEGDRLPVWDEETGGYVDPDTGEPLPTWDEALDALEDPDAEPAHVVRFGPQIDAQGVT
AGSEDADRMIGYLTKYLTKSLDECHSATTDRQRAHVDRLAEALRYEPCSPTCANWLRYGV
QPKNARPGLVPGRCRGKAHRRETLGFGGRRVLVSRKWSGKTLTDHKADRRAWVREQLGAA
GHDTGTGPAAPPDPARYAWELVRPGDPDAPPREHRLLRAIAQRMRWRAQLDQARAAAPGE
DAPATGAAAEAA
Accessions (where available) / Location KPM54784.1
KPM54687.1
EYT90602.1
KFB03026.1
ABD10413.1
KEZ34912.1
ETA00424.1
CAJ60386.1
CAJ64084.1
ABD09791.1
KB896951.1:8452-10164:-
KB896956.1:45792-46934:+
KB895846.1:2390-3394:+
KB895846.1:3422-4174:+
KB896956.1:45337-45807:+
JHVW01000026.1:118154-118495:+
KI912266.1:779673-781385:+
KI912266.1:7941097-7942800:+
KB894856.1:79570-81279:-
BCQP01000056.1:76064-77770:+
BCQT01000002.1:507308-508999:-
KB895037.1:108353-110020:+
KB913022.1:3922015-3923682:-
KB895254.1:3421-4431:-
KB895148.1:21731-22741:+
KB895254.1:2957-3424:-
KB895148.1:22738-23205:+
ACU77378.1
KL575976.1:699-1454:-
JAIZ01000170.1:8520-10139:-
JODS01000019.1:129996-131609:-
BBXF01000002.1:1497207-1498817:+
BBXF01000002.1:304712-306316:-
KL574431.1:2313-2621:+
KL574431.1:2750-4075:+
KL574407.1:132199-132909:-
KL573227.1:10572-11327:+
AXWW01000030.1:51949-52461:+
JNYJ01000032.1:10131-11861:+
BAGA01000070.1:34074-35786:-
BAD55554.1
CRY79952.1
BAGM01000029.1:25290-25598:-
AXVD01000063.1:7688-8080:+
ANAS01000005.1:559586-561208:+
KL574407.1:127834-128397:+
KL575976.1:1-459:-
BBYL01000044.1:40481-40852:+
KL574407.1:133784-134038:-