Cluster: cluster_2311

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-F: 46, CAS-VI-C: 35
Percentage of cluster members that co-occur with known Acrs 4.35
Percentage of cluster members that are adjacent to an HTH protein 82.61
Mean length of the directons containing the candidates 1.826086956521739
Percent of cluster members that occur in self-targeting genomes 17.39
Number of members in the cluster 46
Model score for cluster 0.78
Consensus sequence MMSRTIIKSSGYNFARHKSGSFEINFSEKYSLIHVPATKNKAASNQISPINPLGVYVDCQ
IDNTQ
Accessions (where available) / Location ALJ87788.1
EKP57622.1
ASFN01000024.1:48268-48465:+
EKL54499.1
JQSF01000004.1:9110-9307:-
KLT86407.1
ACJ41489.1
ASFP01000004.1:54424-54621:+
EKP50380.1
ENW68742.1
KLT83917.1
AHAH01000036.1:155679-155876:-
JABT01000041.1:17288-17485:-
EKK08712.1
AJF81858.1
EKA72078.1
ADHB01000081.1:7953-8150:-
AMHW01000102.1:47982-48179:+
AMIV01000296.1:36900-37097:+
ACJ58434.1
EPS74871.1
KLT76246.1
JRWO01000017.1:974156-974353:-
EKK17967.1
ASFX01000013.1:111767-111964:-
CBXD010000050.1:19513-19710:+
ASFS01000042.1:50198-50395:+
KLT91647.1
EGJ58628.1
EKL40683.1
AMHZ01000068.1:36881-37078:-
ASFR01000055.1:66847-67044:-
LAIO01000026.1:36815-37012:-
ADHA01000626.1:7953-8150:-
KIQ72523.1
KGP64915.1
ASFH01000008.1:49485-49682:+
KLT93750.1
LQXZ01000001.1:973672-973869:-
EGJ64556.1
EJO39948.1
KLT75485.1
CRF37768.1
JABU01000047.1:43216-43413:+
JNOU01000117.1:19514-19711:+
ASFK01000008.1:54435-54632:+