Cluster: cluster_2483

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-E: 41
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 55.81
Mean length of the directons containing the candidates 1.604651162790698
Percent of cluster members that occur in self-targeting genomes 0.0
Number of members in the cluster 43
Model score for cluster 0.67
Consensus sequence MATSGCTTTTKINRGDEKEQYIIACGAATPWGVCYDKANALCKNGYKDILKEQGFNRKEL
TIECK
Accessions (where available) / Location AICG01000044.1:40765-41046:-
CCQW01000115.1:4915-5196:+
ELW18077.1
EDU95453.1
YP_009187323.1
ETD64120.1
EZE46928.1
EZB36928.1
ERD34022.1
ERB97807.1
EKI50573.1
YP_009180894.1
EZA88080.1
KNF66672.1
EZD54866.1
EKW74929.1
EKK56307.1
EIN70530.1
EZD65309.1
EZD27620.1
EIP52797.1
EYW91386.1
EZD21688.1
EZB36846.1
KPP21164.1
EZD54286.1
EYZ42538.1
EZD30578.1
ERC43680.1
ERD40932.1
EZE32997.1
EZD36288.1
KNF75058.1
EKI64917.1
ERC05076.1
ERC39032.1
EKI61046.1
EIN59092.1
EZD48349.1
EIO72460.1
ELV89877.1
ERC19733.1
JUSW01000161.1:8154-8372:+