Cluster: cluster_2840

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-B: 37, CAS-IV-A: 1
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 89.19
Mean length of the directons containing the candidates 1.891891891891892
Percent of cluster members that occur in self-targeting genomes 40.54
Number of members in the cluster 37
Model score for cluster 0.48
Consensus sequence MKNNKGTVLEKCEIIKQEDGTYKFIEHLKDGDHEVLLSDVFDQYTGDTDLNITIRLSETI
VQ
Accessions (where available) / Location EQJ51276.1
EQF21905.1
EQJ88593.1
EQH92748.1
EQH87533.1
JXBR01000015.1:14876-15064:+
EQG38265.1
CCL12294.1
EQI89655.1
ABHG02000045.1:87784-87972:+
JXBP01000014.1:96125-96313:+
EQE71984.1
EQI31750.1
EQF64809.1
CCL24380.1
ADEJ01000893.1:24344-24532:-
EQE71525.1
EQE22689.1
JXBQ01000012.1:93208-93396:+
EQF07388.1
JXCP01000015.1:37999-38187:-
ABHD02000059.1:15986-16174:+
EQH15619.1
EQL04408.1
EQF42472.1
EQF16050.1
EQH27412.1
EQF50131.1
EQJ06248.1
EQE50997.1
EQG33520.1
EQJ49170.1
CCL51139.1
EQF27311.1
CCL55097.1
EQF57087.1
EQE95415.1