Cluster: cluster_286

CRISPR-Cas subtypes that co-occur with the candidate CAS-IV-A: 9, CAS-I-E: 254, CAS-I-F: 12
Percentage of cluster members that co-occur with known Acrs 4.12
Percentage of cluster members that are adjacent to an HTH protein 1.86
Mean length of the directons containing the candidates 1.7695167286245348
Percent of cluster members that occur in self-targeting genomes 6.37
Number of members in the cluster 269
Model score for cluster 0.65
Consensus sequence KSMTVLPSGEAPTMSSLEMVDYINADRKSKAEAEGLSFPCKKYRKLQHKNFMKKVPKVLG
EAFSADFFADGDGGGRERDCYRFPKREACLMAMSYSYELQAQVFDHMTELEMDMASLAER
AVNEMSDRVGEGENYAAIMPVEKKLGQKFKWQPLRKWCRENDMLPHDVDDPRFGDVGDWP
RGAWAAVYGVDLRKLF
Accessions (where available) / Location CRP74461.1
CRP38525.1
JTOT01000023.1:195423-196217:+
CRS13403.1
ERU84202.1
CRP12244.1
CUXV01000065.1:330547-331341:-
CRN18937.1
CRP13469.1
CRQ96053.1
ETU96283.1
LFMR01000001.1:2607491-2608285:-
ERU86062.1
AUCC01000223.1:353-976:+
EDU57643.1
EJZ64328.1
ALXE01000018.1:73078-73674:-
AKH27132.1
AKH22937.1
AEJY01000065.1:121-717:-
JHRX01000084.1:1330-1926:-
BBVP01000037.1:8237-8833:-
BBVO01000022.1:56673-57269:-
BBVZ01000031.1:464-1060:-
KER03382.1
ETS31073.1
AMG68776.1
KMW73584.1
CDH26391.1
CBJ89907.1
CEK22787.1
CDH26390.1
JUIT01000023.1:6249-6539:-
AHB96707.1
EYH96909.1
KJT74987.1
KJU36089.1
ELX21607.1
KDU70328.1
EYI15876.1
EYI47987.1
EJW23027.1
ESE54412.1
KJU18031.1
KJU16365.1
KNW04299.1
KNU27854.1
EIC46226.1
EYI26490.1
EYH85174.1
EJW23588.1
EYI46633.1
KOJ04951.1
EYE76081.1
KTN02308.1
KNL07089.1
KUB82839.1
EIC42119.1
KUB69762.1
KMV34045.1
EYH84107.1
KTZ53899.1
KNL58598.1
KJT34431.1
KOP05106.1
KTY73560.1
KKD79849.1
KUA13738.1
KNL29461.1
KNU02267.1
KJU62212.1
KDR97197.1
KJT73870.1
KDS02536.1
KNW43650.1
KTM14370.1
KTW78219.1
KUB49475.1
KHQ74856.1
KTZ04599.1
KTO76964.1
KUC84285.1
KKD77611.1
KJT21436.1
KNK32327.1
EYE82857.1
KNQ37818.1
KJT37116.1
KNT20917.1
KUE18108.1
KNN56774.1
KUE08454.1
KNN83828.1
KNM82247.1
KNT73223.1
EYI93255.1
KNT29381.1
KNS72165.1
KTN73360.1
EYH50338.1
KJT71793.1
ALN31693.1
KNM84000.1
KUA33126.1
KNV87984.1
EYI88128.1
KKE18483.1
KOJ34325.1
KTZ27839.1
EYI34373.1
KNK64986.1
KNQ49306.1
KNP11317.1
KNW38453.1
KJU23975.1
KUB84861.1
KTX91245.1
KTO57676.1
EIC31974.1
KJU09241.1
EYH63714.1
KJT08347.1
EYI61338.1
KJU57912.1
KTZ68278.1
KNU37228.1
KTX10011.1
KHO86549.1
KNH79580.1
KNP20019.1
EYI76366.1
KOJ24425.1
EYI04854.1
KTZ33807.1
KHP02466.1
KNK55886.1
KNQ19933.1
EYH61551.1
KNP51263.1
KNT56204.1
EJW38154.1
KNL35029.1
EYI48073.1
ALN26981.1
KOJ18935.1
EIC46546.1
KJT16900.1
KNK86318.1
KNI43931.1
KTY44721.1
ESE57046.1
KNI57056.1
AGQ80093.1
KDU75099.1
EIC40044.1
KJT25811.1
KDS10249.1
KUB72470.1
KJU64348.1
KJT31995.1
KJT78729.1
KNN78346.1
AGQ70716.1
KNL25053.1
KJT83725.1
KUC32895.1
KNS56055.1
KUC97231.1
AFH44383.1
KOK01875.1
KNN37663.1
KJT59977.1
KNT39411.1
KNU72704.1
KNV87490.1
KNS00031.1
KHO94368.1
KNK07716.1
KTP33352.1
KJU42933.1
KTW36823.1
EYI02945.1
KNS43610.1
KTO93741.1
EJW23915.1
KTO41205.1
EYI65764.1
EYI23723.1
EYE78455.1
EYH58356.1
KUA44742.1
KNN70326.1
KNP09795.1
EYI77106.1
KJT96077.1
KTZ93339.1
KJU41263.1
KNI99415.1
KTN78346.1
AGQ63797.1
KNH90613.1
KTY99317.1
KNN79181.1
KHD83630.1
EYI61205.1
KNI77226.1
KTZ17202.1
EYH98695.1
KJT46430.1
KJT55815.1
KNV58683.1
KNK73140.1
KNT23794.1
KNL50294.1
KNQ40498.1
KUD45154.1
ESG51186.1
KJT91193.1
KTY03245.1
KNP69125.1
KNX27750.1
KNL11528.1
KHO86806.1
KTW48377.1
KNN48159.1
KNW00573.1
KNV90564.1
KNK97596.1
KOK79370.1
KTY27713.1
KTW47043.1
KNI83988.1
EYI21174.1
KJU17320.1
EYI81090.1
KOO96056.1
ALN22400.1
EYH74893.1
KTO30388.1
KNQ60037.1
KNK16469.1
KNO09279.1
EYI13465.1
KJT90730.1
ESE46751.1
EYI40903.1
KJU11364.1
KOK66119.1
EYI88742.1
KNK62867.1
KNK34392.1
KJU56693.1
KNL93854.1
KNU06476.1
KJU32829.1
ETC34644.1
ETC20844.1
ETB85775.1
ETC55474.1
ETC70243.1
ETC22528.1
ETC09872.1
ETB74409.1
ETC01249.1
ETC48564.1
ETC11303.1
ETC19953.1
ETB80162.1
ETB92019.1