Cluster: cluster_3039

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-B: 21, CAS-I-E: 15, CAS-I-C: 20, CAS-IV-A: 2
Percentage of cluster members that co-occur with known Acrs 38.24
Percentage of cluster members that are adjacent to an HTH protein 88.57
Mean length of the directons containing the candidates 3.542857142857143
Percent of cluster members that occur in self-targeting genomes 50.0
Number of members in the cluster 35
Model score for cluster 0.79
Consensus sequence METEELLEEGMRIRNKTRIEILLYRNDFREETTDPGLYKNLKIPDFEIRIGDTCLSFLDK
GNLFYYTNSINDVERILKYIQTKWKEEKKKGIDIPFSAYLKVASGRNHDAA
Accessions (where available) / Location JQRT01000018.1:67431-67784:-
JQRU01000041.1:6200-6553:+
EMJ95519.1
EKR98074.1
EMO50529.1
EMO54798.1
JQRF01000044.1:8083-8418:+
JQRC01000115.1:25521-25856:-
EKR71844.1
LHQT01000015.1:30507-30842:-
EMO66437.1
EMO39550.1
EMO14641.1
EMI68185.1
EMO21790.1
EKO78061.1
EMO47034.1
EMF91187.1
EKS06910.1
EMO21824.1
EQA61430.1
AOUT01000057.1:26127-26471:-
JQOZ01000011.1:4439-4771:+
JQPA01000047.1:27440-27772:-
JQPH01000085.1:5634-5966:+
EMJ34073.1
EMN94376.1
JQPV01000086.1:1709-2041:+
JQPT01000200.1:25896-26228:-
EKR56580.1
AHQS01000048.1:6355-6687:-
KGE21907.1
AHQW01000011.1:53617-53949:-
JQQW01000158.1:5369-5671:+
EMN89892.1