Cluster: cluster_3207

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-E: 30, CAS-I-F: 3
Percentage of cluster members that co-occur with known Acrs 14.29
Percentage of cluster members that are adjacent to an HTH protein 12.12
Mean length of the directons containing the candidates 4.363636363636363
Percent of cluster members that occur in self-targeting genomes 10.71
Number of members in the cluster 33
Model score for cluster 0.36
Consensus sequence MTDAHRFGFTLPADGEHLLATPWQHIFYLGGGKALSPGCGAYCSPAAAEIKPVRKAGDKG
DCRATG
Accessions (where available) / Location CCQS01000258.1:5824-6051:-
ENB40863.1
ENG86678.1
CAR07219.1
KEJ74960.1
ABE06957.1
EHW66535.1
EMZ97317.1
EHX81986.1
EHW18220.1
KDW19077.1
EMW98587.1
EMV62076.1
ENF42436.1
CDK47584.1
CAU97577.1
CAU97233.1
KEN93485.1
EMX00201.1
EMV45501.1
ENB38946.1
KEJ80053.1
KEJ76729.1
KEO32783.1
ENA82130.1
KEJ76300.1
CRL88507.1
EHW78047.1
EHV74566.1
EFX21322.1
EFX27112.1
ENH57750.1
EKH46879.1