Cluster: cluster_3300

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-C: 21, CAS-VI-A: 1, CAS-II-A: 2, CAS-II-C: 1, CAS-III-D: 3, CAS-I-F: 2, CAS-I-B: 5, CAS-III-A: 2, CAS-I-C, CAS-III-D: 1, CAS-III-B, CAS-I-B: 1, CAS-V-A: 2, CAS-III-B: 1, CAS-I-E: 1
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 34.38
Mean length of the directons containing the candidates 3.78125
Percent of cluster members that occur in self-targeting genomes 13.79
Number of members in the cluster 32
Model score for cluster 0.5
Consensus sequence MWKEGTIGIPKKDGRYTVVHYWVKHYEEPSEYGIDGGRISKLSLKIDGKTVCNYDRGWDI
EPEDEEAELALAILLHEYN
Accessions (where available) / Location LBCK01000008.1:97-495:-
LBCK01000004.1:202652-203047:-
ACOK01000108.1:53686-53982:+
JAEF01000025.1:749-988:+
KK211346.1:89514-89753:+
JAGT01000001.1:1233423-1233662:-
AUJE01000003.1:34890-35246:-
JNIO01000008.1:266750-266974:+
EGC74957.1
KQC86202.1
EHO29835.1
KGJ52450.1
EHO26967.1
EQJ61815.1
EFR38674.1
EGB18624.1
EDR98690.1
ENZ13260.1
JNJN01000033.1:26285-26533:+
CCY17257.1
CUX39839.1
ADU27358.1
EOS41434.1
EOS27994.1
EOS74893.1
EOS43486.1
EOS72949.1
KGP77236.1
EHL65448.1
EFE46519.1
CABY01000005.1:193817-194059:-
CDC46979.1