Cluster: cluster_334

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-E: 239, CAS-I-F: 1
Percentage of cluster members that co-occur with known Acrs 1.25
Percentage of cluster members that are adjacent to an HTH protein 70.0
Mean length of the directons containing the candidates 4.9125
Percent of cluster members that occur in self-targeting genomes 20.0
Number of members in the cluster 240
Model score for cluster 0.67
Consensus sequence MADIVQSDLADNFRVTITDGRGLELLSFRLAAEERYIISTRDGSVTNRKLSRDDLYWSKE
TIMEVVREMGSNN
Accessions (where available) / Location KTZ05536.1
KPE08448.1
AUVD01000015.1:18646-18867:-
KNM84413.1
KKE56261.1
KNI97523.1
KNQ62616.1
KNP14943.1
KTW50030.1
KPB06949.1
EQM58725.1
KOJ21972.1
KOK09416.1
KNV11187.1
KTP21639.1
KKE39520.1
KUA33374.1
KNQ13379.1
KPE70760.1
KNL33671.1
KTP05985.1
KNV24246.1
KNW84816.1
LN999997.1:4301548-4301769:-
KSA96434.1
KTN99002.1
KPE99687.1
KKD91016.1
KNN00692.1
KOJ45418.1
KUA68368.1
KTN91742.1
KTM40864.1
KNS67094.1
EQM57938.1
KTM79916.1
AGQ68339.1
KNQ20719.1
EYR76888.1
KNT31848.1
KTO52798.1
KTM38567.1
KPE72075.1
KPF19396.1
EQM56270.1
KNK26696.1
KUA84496.1
AGQ72754.1
KNQ47443.1
KPF21832.1
KNP22795.1
KUB86782.1
KPF15026.1
KNQ39004.1
KUC99995.1
KUA39179.1
EQM61473.1
KPF24138.1
KNT86041.1
KTN21925.1
KUE62285.1
EQM57389.1
KTQ19308.1
KNT48675.1
KOJ10581.1
ERO25491.1
KSB63029.1
KPF02616.1
ERO22726.1
KNT59888.1
KOJ67744.1
CACD01000027.1:3848-4069:+
KTW85842.1
KNM20172.1
KOH62463.1
KKE09854.1
EQM36041.1
KNV01346.1
KOH83999.1
KNT36840.1
KHD79387.1
KNP47362.1
KUB59009.1
AMG26898.1
KNS00062.1
KOJ46867.1
KOH84475.1
KTP89406.1
KPE86857.1
KNP09424.1
KUB56155.1
KUE33575.1
KUA99634.1
ERO10936.1
ESV50540.1
KNI30748.1
KOJ73530.1
KOM10397.1
KTL71069.1
KTY29544.1
KTO36346.1
KOJ87746.1
KMJ67155.1
KNK48809.1
KPE82734.1
KTO49904.1
KUC69764.1
KTO74014.1
JUIT01000025.1:73187-73408:+
ACY87651.1
KKD81256.1
KUB86062.1
ALH02632.1
AHW19451.1
KUC32618.1
KKE20865.1
KNM80014.1
ARYR01000083.1:40485-40706:+
KPF17793.1
KPE79597.1
KTN59695.1
KTM32169.1
KTP17122.1
KUA22496.1
KNK07552.1
KPE93382.1
KUC61322.1
KTM84690.1
KTN91720.1
ERO27912.1
KNP75418.1
KNV74839.1
KTY72073.1
KNI98088.1
KUA01629.1
KNV91759.1
ALPP01000006.1:28699-28920:-
KPE57738.1
KOK00053.1
KTO22812.1
KSB37544.1
KNK38585.1
JRGR01000065.1:178-399:-
KTO26901.1
KNW05413.1
KPF32722.1
KUB76312.1
KTZ41029.1
KNK58738.1
KTM09658.1
EQM59399.1
KTM98560.1
KUB30310.1
KKD80327.1
KTP84475.1
KTZ88890.1
KKE29436.1
KKD94061.1
KOJ17243.1
KNK55447.1
KTQ25647.1
KTL63861.1
KOK89787.1
KSB15238.1
KTL95089.1
KTL79830.1
KPF06862.1
KOK88628.1
KTA15980.1
KNN34551.1
KNL54066.1
KNS84801.1
LFCC01000180.1:1386-1607:-
KNO78401.1
KTN71253.1
KNV31077.1
KNL35705.1
KNS05801.1
EQM56807.1
KPF06902.1
KNV10467.1
KTO53637.1
KTN63619.1
KUA64958.1
KUD58467.1
AGQ85662.1
JRGT01000111.1:178-399:-
KTP44755.1
KNQ05719.1
KUB74151.1
KTP82220.1
KTW61645.1
KTW51203.1
EQM51971.1
KKE72894.1
KNP52707.1
KTW75852.1
KNS86239.1
KTW77841.1
KUB42759.1
KTZ19805.1
KNV21008.1
KTO69409.1
KPE55338.1
ESJ22211.1
EQM55626.1
KUD84509.1
KTQ40888.1
KTM51622.1
EQA23410.1
KNU11723.1
KNU32243.1
KOJ99203.1
KNI67582.1
KNV49097.1
KUD25816.1
KNS95256.1
KUB94203.1
KNX06572.1
KLR01604.1
KNW12320.1
KUC82690.1
KNT36196.1
KNP53913.1
KNU79313.1
KUD46272.1
KNQ67767.1
KNU90376.1
KTY56679.1
KTW72279.1
KNK79807.1
KUA63952.1
KNN39031.1
ESB80163.1
ETC32122.1
KUD08320.1
KNI09805.1
KNV27838.1
KUA21175.1
ERN92122.1