Cluster: cluster_3367

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-C: 20, CAS-I-E: 6, CAS-VI-A: 3, CAS-II-A: 4, CAS-V-A: 1, CAS-II-C: 4, CAS-III-D: 3, CAS-III-A: 3, CAS-I-B: 1, CAS-III: 1
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 16.13
Mean length of the directons containing the candidates 2.838709677419355
Percent of cluster members that occur in self-targeting genomes 38.1
Number of members in the cluster 31
Model score for cluster 0.55
Consensus sequence MGYKRKDYYDLKKRNEIREQAKRLRKKFLRYKEGEIVYSLGHKKFMELAKEAGAVYRIDG
VVLVNREIFDEYLEQFREPSTMASQEDKE
Accessions (where available) / Location AUJT01000024.1:20049-20504:+
JQKK01000014.1:63228-63509:-
BAHS01000048.1:19466-19822:-
BAII02000003.1:23764-24120:+
BBZR01000006.1:171613-171885:+
KUE76674.1
AUDP01000005.1:137287-137559:+
ERT30047.1
JNKJ01000006.1:113153-113425:+
JPJF01000020.1:4959-5231:+
EDP20874.1
AUJS01000020.1:51339-51674:+
ADJS01011657:752-979:-
EDP15106.1
AUJT01000024.1:25148-25471:+
EHF00977.1
EGC74084.1
EDS07899.1
JNJM01000036.1:1803-2129:-
EDN76900.1
ADJS01013912:3168-3377:-
ERI97529.1
KUE76535.1
BAHS01000021.1:39063-39272:-
JPJF01000014.1:54187-54396:-
ERT29893.1
CCYH01000039.1:15442-15651:-
BBZR01000007.1:158173-158382:+
EDP20852.1
BAII02000007.1:50942-51151:+
AUDP01000023.1:78916-79125:+