Cluster: cluster_3580

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-C: 4, CAS-II-A: 28
Percentage of cluster members that co-occur with known Acrs 3.45
Percentage of cluster members that are adjacent to an HTH protein 10.34
Mean length of the directons containing the candidates 4.275862068965517
Percent of cluster members that occur in self-targeting genomes 24.14
Number of members in the cluster 29
Model score for cluster 0.7
Consensus sequence MRPKRYPYGKSYPSNKLSKPIKELTIIFRGNESVPEVILNGINFKNSRAGLVSLNLNWHT
KDIQSIDELVERKVSLEYYDNPGLDMSLCKLSQSFKL
Accessions (where available) / Location AKG28102.1
ATXR01000001.1:22069-22365:-
AAM79312.1
ESU90551.1
EZL78353.1
EZK78593.1
BAC64242.1
EZN36387.1
AIG47423.1
EZK69680.1
EZL01384.1
EZK93080.1
EZL46924.1
AIL10637.1
EZN32752.1
EZL70392.1
EZL76182.1
EZK83489.1
EPW78326.1
EPW23605.1
EPV01430.1
EQA29431.1
EPW89734.1
EPV43237.1
KXA51439.1
KE375897.1:1790-2044:+
ATOT01000060.1:13103-13357:-
EPT58633.1
KKF47146.1