Cluster: cluster_3609

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-B: 3, CAS-I-E: 24, CAS-I-C: 3, CAS-V-B: 1
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 100.0
Mean length of the directons containing the candidates 3.724137931034482
Percent of cluster members that occur in self-targeting genomes 13.79
Number of members in the cluster 29
Model score for cluster 0.47
Consensus sequence MLATPSGTPACPDPARQHRLAAQLADMIPGAATIRVSLTDPSQTWPHPHARAYDEAGQTI
PLNRTTARVAARWILRVWPEADWTEPHTLDLATGTLTRSDLVAAGRGR
Accessions (where available) / Location EDY48222.1
EFG07545.1
EIF92648.1
CM001015.1:2906259-2906513:+
ALAP01000097.1:59530-59895:+
JOHT01000033.1:35847-36206:-
BBYG01000010.1:125518-125877:+
KMS74408.1
KOG29584.1
EKX65426.1
JOJK01000008.1:241611-242012:-
JTCK01000050.1:24083-24409:+
AUKO01000013.1:205663-205989:+
KDQ66962.1
KRA40703.1
KQX30769.1
KIF77298.1
KL589952.1:73244-73570:-
EGJ77907.1
JODY01000020.1:48078-48401:-
BARF01000092.1:45011-45334:-
KPI14584.1
LBNW01000459.1:4302-4622:-
KND43832.1
KUO20787.1
KND38293.1
KOV12347.1
JAIZ01000019.1:9079-9393:+
JNYE01000023.1:27581-27910:+