Cluster: cluster_3727

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-B: 23, CAS-II-A: 3, CAS-V-A: 21, CAS-III-A: 9, CAS-III-D: 2
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 17.86
Mean length of the directons containing the candidates 5.0
Percent of cluster members that occur in self-targeting genomes 25.0
Number of members in the cluster 28
Model score for cluster 0.45
Consensus sequence MNKNKAFSLMEVIVSVFILILVLIPSIKLNIQQIKTYSKIRNADSELHFFTSLNNYLKAE
NIINSHLEFNNYTDFITTFNNFGNSFQNLKNKNFNLIIDMEKTEVDFSNRKENASLIKVE
YRGDKKIYKNTLLKFEE
Accessions (where available) / Location AKBT01000002.1:57743-58195:-
EEU31423.1
EHO76923.1
ALQ38470.1
EJU07747.1
EUB15197.1
ALQ34589.1
EGN65078.1
EEO43701.2
ALF23364.1
ALQ43340.1
ERT41681.1
ATKF01000041.1:12451-12864:-
ALQ39445.1
ETZ25115.1
ERT48109.1
ATKC01000054.1:18551-18964:-
EFG35282.1
ALF20295.1
AKCE01000001.1:690184-690597:+
EUB38091.1
EEO41295.2
EHG18078.2
ALM94909.1
CKG60047.1
AGM22498.1
EEW94623.1
ALF22693.1