Cluster: cluster_3799

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-B: 1, CAS-I-U: 19, CAS-I-E: 18, CAS-I-C: 8, CAS-III-B: 2, CAS-III-D: 2
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 11.11
Mean length of the directons containing the candidates 3.814814814814815
Percent of cluster members that occur in self-targeting genomes 29.17
Number of members in the cluster 27
Model score for cluster 0.42
Consensus sequence MAPLTGLEVWLVGTPAELDAATRALTAAGRIAQRGQRHPLTGADTGRHRLYLRLTITTTR
RARPAPPPPDQGGAVLDLDTARAQRRAA
Accessions (where available) / Location AZWX01000031.1:6313-6615:+
KB896015.1:49428-49730:+
KB905220.1:29965-30264:+
KUJ46855.1
AEB47846.1
JNLS01000016.1:76325-76603:+
AZWU01000051.1:19999-20274:+
KI912589.1:18271-18510:+
AZXD01000018.1:49876-50154:-
AZWF01000009.1:59869-60147:+
KB896706.1:60001-60276:+
AZWJ01000005.1:83558-83830:+
AZXH01000009.1:101602-101874:+
KB900388.1:4013632-4013904:-
KIR64269.1
JNZS01000011.1:217368-217613:-
AZWF01000008.1:1370-1651:-
KB895234.1:61595-61876:-
AZWF01000017.1:147547-147819:+
KB896099.1:37085-37357:-
KB900271.1:30957-31229:+
AUKL01000049.1:6191-6463:-
AZWV01000026.1:37085-37357:-
KXK58525.1
KXK61078.1
KB896637.1:52888-53148:+
KB904947.1:15475-15726:+