Cluster: cluster_3962

CRISPR-Cas subtypes that co-occur with the candidate CAS-III-D: 1, CAS-I-E: 3, CAS-I-C: 4, CAS-VI-A: 1, CAS-II-C: 1, CAS-I-B: 2, CAS-II-A: 13, CAS-III-A: 5
Percentage of cluster members that co-occur with known Acrs 3.85
Percentage of cluster members that are adjacent to an HTH protein 11.54
Mean length of the directons containing the candidates 2.3076923076923066
Percent of cluster members that occur in self-targeting genomes 15.38
Number of members in the cluster 26
Model score for cluster 0.46
Consensus sequence FDNVKQESSFSTASGSNGDHYVVLQVVLKEKFIGTGSGNLTELEDVINKQAAKGYRLHTI
TTANGGSKGFGGGDRIQATMVFEKID
Accessions (where available) / Location JNKP01000001.1:559388-559702:-
AMZK01000027.1:20474-20755:+
ACOK01000103.1:26741-27010:-
EEP28245.1
AMB92464.1
ERJ91530.1
BBYO01000007.1:182073-182279:+
KLE15316.1
KFN86434.1
JVPZ01000003.1:65253-65522:+
KEY47624.1
EMG32937.1
JVQE01000030.1:24104-24373:+
JWCV01000092.1:46442-46711:+
JUQX01000045.1:34993-35262:-
JVYO01000004.1:45042-45311:-
JXRG01000002.1:6550-6819:+
KXT81655.1
HE978532.1:60964-61173:-
EOU18699.1
LDNF01000067.1:36495-36701:+
EJV55755.1
CVRN01000006.1:423534-423740:-
EOT31689.1
ETD26210.1
KEQ37729.1