Cluster: cluster_4038

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-E: 26
Percentage of cluster members that co-occur with known Acrs 26.92
Percentage of cluster members that are adjacent to an HTH protein 100.0
Mean length of the directons containing the candidates 3.8461538461538463
Percent of cluster members that occur in self-targeting genomes 11.54
Number of members in the cluster 26
Model score for cluster 0.44
Consensus sequence MLNVQEKVSIVNELRQEWSLSRLLIVSGLSGVHFTIMSDGLLLLTGISLPERLC
Accessions (where available) / Location CDRY01000152.1:26780-26944:-
KEL86102.1
EZJ44942.1
EZJ60854.1
CCBW01000195.1:1198-1362:+
EHY08697.1
EKH97360.1
KEL68841.1
EHV74522.1
KDW22216.1
KDZ47241.1
EZK52708.1
CCBX01000474.1:1263-1427:+
EHY10503.1
CDRU01000415.1:5096-5260:-
KDZ42438.1
KDT22125.1
JSSS01000034.1:6286-6450:-
KDW35694.1
EMX87732.1
EZJ23844.1
KDW96120.1
EHY16688.1
KEK85732.1
KDW29097.1
EHY20484.1