Cluster: cluster_4159

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-B: 20, CAS-II-A: 18, CAS-II-C: 4, CAS-I-C: 1
Percentage of cluster members that co-occur with known Acrs 36.0
Percentage of cluster members that are adjacent to an HTH protein 8.0
Mean length of the directons containing the candidates 2.56
Percent of cluster members that occur in self-targeting genomes 36.0
Number of members in the cluster 25
Model score for cluster 0.23
Consensus sequence MLSEKAKEARRVYQQQWRDKNREHVREYSRKWREENQEKQEAAINRYWERKANELIAN
Accessions (where available) / Location CWLE01000104.1:855-1031:-
CWLC01000026.1:31416-31592:+
CWMG01000027.1:937-1113:+
CWLA01000019.1:30983-31159:+
JRYY01000003.1:136662-136838:+
CUL14505.1
CWMX01000162.1:768-944:+
CWNA01000037.1:40766-40942:+
CWMK01000025.1:893-1069:-
CUL64222.1
NP_463501.1
CUL26006.1
CWNI01000220.1:1519-1695:+
EHN62248.1
CUL35427.1
CWLH01000115.1:855-1031:-
CWLV01000039.1:36074-36250:-
CUL82015.1
CWLM01000007.1:40945-41121:+
CWLQ01000002.1:31404-31580:+
CWLR01000013.1:109330-109506:-
CUK99062.1
CUL45468.1
EHO32916.1
EJV41768.1