Cluster: cluster_42807

CRISPR-Cas subtypes that co-occur with the candidate None (candidate detected solely in phages)
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 66.67
Mean length of the directons containing the candidates 2.666666666666667
Percent of cluster members that occur in self-targeting genomes 0.0
Number of members in the cluster 3
Model score for cluster 0.52
Consensus sequence MRIETTPPARWHGINDAEIRAVVSYPALQVPIAPRRAGAAPVLFIGPPGANEPYIEVIAD
LADPSVAVVFHAMMLRRQLVASLGLEAYLPPDIYGPQRPQRR
Accessions (where available) / Location YP_009013644.1
YP_009289848.1
YP_009303418.1