Cluster: cluster_4289

CRISPR-Cas subtypes that co-occur with the candidate CAS-II-A: 20, CAS-I-E: 4, CAS-III-A: 4, CAS-I-C: 2, CAS-II-C: 2
Percentage of cluster members that co-occur with known Acrs 26.09
Percentage of cluster members that are adjacent to an HTH protein 54.17
Mean length of the directons containing the candidates 5.0
Percent of cluster members that occur in self-targeting genomes 21.74
Number of members in the cluster 24
Model score for cluster 0.8
Consensus sequence MGLFNNQERVNRGAAMKATPPKPVQEIEMIVEYFDKTVETISITYNLEELQKLVSSSFGT
GASMNFSSANPPFSINPRWVKKITYRTKSD
Accessions (where available) / Location KLK78851.1
KLJ40052.1
KXT59306.1
KXT80345.1
EFU63490.1
KEQ34366.1
CBZ48564.1
CBZ49232.1
KIC79117.1
EMC14303.1
JWGO01000034.1:26689-26967:+
EMB67398.1
JWGS01000022.1:40519-40797:+
ALYX01000022.1:264069-264347:-
EMC59820.1
EMC59263.1
KUM01052.1
EKS18348.1
KLK48815.1
JVMU01000040.1:56426-56692:-
EGL85603.1
EIC76314.1
JVJI01000125.1:55053-55319:-
JVNG01000025.1:56426-56692:-