Cluster: cluster_4302

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-B: 24
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 95.83
Mean length of the directons containing the candidates 4.541666666666667
Percent of cluster members that occur in self-targeting genomes 54.17
Number of members in the cluster 24
Model score for cluster 0.79
Consensus sequence MLNIEEYSKILSDFVDYINNIEDMDLYLDDSILYGDYKINCGVDDRDIIDFNYQSFNSKV
TLFAGHIGNEIIQAAL
Accessions (where available) / Location EQK14874.1
EQG89788.1
EQI94214.1
EQG55317.1
EQJ16400.1
EQG27304.1
ERM41476.1
EQK64085.1
EQJ05085.1
EQG74498.1
EQJ00448.1
CM000604.1:3525092-3525322:-
ERM33536.1
KLR55726.1
EQJ80919.1
EQE01486.1
EQJ76702.1
EQH06738.1
EQE03525.1
EQK26962.1
EQI33050.1
EQE02592.1
EQH02149.1
EQK29946.1