Cluster: cluster_4442

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-C: 2, CAS-II-A: 19, CAS-I-E: 1
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 8.7
Mean length of the directons containing the candidates 2.608695652173913
Percent of cluster members that occur in self-targeting genomes 4.55
Number of members in the cluster 23
Model score for cluster 0.64
Consensus sequence MNDLLIQHQLEDCRPIREYKAKIIIKLLEDNQTLPRNERNSQIQALREANQKTDEIVQKV
MATIKHDRTAFCRDHCWLYQIREERINKILEQLAKED
Accessions (where available) / Location BACQ01000033.1:24575-24877:+
KRK11616.1
BAI43120.1
CAR88595.1
EPC96223.1
AEA53279.1
CAQ66045.1
EKQ23661.1
EPC82982.1
AGP67701.1
CM001861.1:920914-921207:-
BAGT01000183.1:8368-8661:+
EPC31012.1
EEQ64571.1
YP_009201520.1
AEA56439.1
CCK21878.1
CM001848.2:934143-934436:-
ERN49281.1
EPC18121.1
GAN38862.1
EEQ65407.1
GAN37539.1